PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 357aa    MW: 37964.8 Da    PI: 9.0855
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030336genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.67.1e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ede+l ++v ++G+++W++I++ ++ gR++k+c++rw + 
      Lus10030336 12 KGPWSPDEDEKLHNLVDKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding513.3e-1666108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
      Lus10030336  66 AFTVEEDDTIIRAHARFGNK-WATIARLLH-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.673762IPR017930Myb domain
SuperFamilySSF466893.59E-319105IPR009057Homeodomain-like
SMARTSM007171.5E-161160IPR001005SANT/Myb domain
PfamPF002492.0E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-251365IPR009057Homeodomain-like
CDDcd001675.82E-161456No hitNo description
SMARTSM007171.5E-1363111IPR001005SANT/Myb domain
PROSITE profilePS5129419.86264113IPR017930Myb domain
CDDcd001671.05E-1066109No hitNo description
PfamPF002497.2E-1466108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2266112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MAFTGKEIDR IKGPWSPDED EKLHNLVDKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTVE EDDTIIRAHA RFGNKWATIA RLLHGRTDNA IKNHWNSTLK RKCSSSSQDV  120
GGGDQGYDGN LGDCCQPLKR SMSAGSGLPV STGLTMNPAS PSGSDVSDSS SVPNPPPPPP  180
VLLPPPPPPP PPPASTSTSS HVFRPVPRTG GVAPPPETKL SNNRNDDDLA TSLSLSLPGT  240
DSSSEVSTPR VPEAAHLHQK QQQRNKPVVA VTLPPLPAMN RPVSMDIQAP SEMGAEFMSV  300
IQDMIKMEVR SYMMEQRRGV AGGGGNGGGG GMCFQAAGGS GFKNVVAVKR VGGWEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-40111123104MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-40111123104C-Myb DNA-Binding Domain
1msf_C7e-40111123104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002524926.11e-127PREDICTED: transcription factor MYB44
SwissprotQ9FDW18e-96MYB44_ARATH; Transcription factor MYB44
TrEMBLB9SG071e-127B9SG07_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0007s10490.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-76myb domain protein 73